PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000492221
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 332aa    MW: 38428.5 Da    PI: 6.8368
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000492221genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.71.3e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l d+++++G g+W+t ++  g+ R++k+c++rw +yl
    MDP0000492221 14 KGPWTPEEDQKLMDYIQKHGYGNWRTLPKNAGLQRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding54.72.4e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr++ eE+e +++++  lG++ W++Ia++++ gRt++++k++w+++
    MDP0000492221  67 RGRFSFEEEETIIQLHSILGNK-WSAIAARLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-26564IPR009057Homeodomain-like
PROSITE profilePS5129418.794961IPR017930Myb domain
SuperFamilySSF466892.62E-3211108IPR009057Homeodomain-like
SMARTSM007177.0E-131363IPR001005SANT/Myb domain
PfamPF002491.1E-161461IPR001005SANT/Myb domain
CDDcd001677.72E-121661No hitNo description
PROSITE profilePS5129425.25562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-2665116IPR009057Homeodomain-like
SMARTSM007171.8E-1666114IPR001005SANT/Myb domain
PfamPF002491.1E-1567111IPR001005SANT/Myb domain
CDDcd001675.12E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MGRAPCCDKS GLKKGPWTPE EDQKLMDYIQ KHGYGNWRTL PKNAGLQRCG KSCRLRWTNY  60
LRPDIKRGRF SFEEEETIIQ LHSILGNKWS AIAARLPGRT DNEIKNYWNT HIRKRLLRMG  120
IDPVTHIPRL DLLDFSSILY NSSHHHHQMN NFSRLLGQPI GLNPELLRLA TSLIQSHRES  180
NSNQNFVLQN AQENDYHQIC NPQIQVSNQV QCNQLQQPIQ HNVPYANEAA QIMQQQPNVE  240
YPSXLSDFRS QISQHNEWQS NAGTSNFTEE YVELPSFAYF GSEQNQTVLD ISPETSNIHS  300
NNSNQNFSFT SVFFDAFFKP DAYEFEFDNI F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-30121165108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.30080.0fruit| leaf| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5076711e-120AY507671.1 Malus x domestica putative MYB transcription factor (MYB) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008358698.10.0PREDICTED: LOW QUALITY PROTEIN: protein ODORANT1-like
TrEMBLD9ZJ640.0D9ZJ64_MALDO; MYB domain class transcription factor
STRINGVIT_00s0203g00070.t011e-129(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF85034127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.11e-109MYB-like 102